Brainpeps Results

Brainpeps®

Search hits: 20
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)t1/2, serum11
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38HPLCt1/2, serum30
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AHPLCt1/2, serum35
15RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2Orexin BHPLCt1/2, serum35
31YPWF-NH2Endomorphin-1HPLCt1/2, serum97
32YPFF-NH2Endomorphin-2, Endomorphin IIHPLCt1/2, serum97
40YtGFLS-NH2SAM 995HPLCt1/2, serum26
40YtGFLS-NH2SAM 995HPLCt1/2, serum26
41YtGFLS-(β-D-Glc)-NH2SAM 1095HPLCt1/2, serum26
41YtGFLS-(β-D-Glc)-NH2SAM 1095HPLCt1/2, serum26
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Intravenous injection (multiple time regression)t1/2, serum149
74fCYwRT-Pen-T-NH2Connective tissue-activating peptideHPLCt1/2, serum97
93YaG-(N-Me)F-G-OH [(D)Ala2, (N-Me)Phe4, Gly-ol] EnkephalinHPLCt1/2, serum97
104YrFSar TAPSHPLCt1/2, serum97
105YaFF-NH2 TAPPHPLCt1/2, serum97
106fCYwOrnTPenT-NH2 CTOPHPLCt1/2, serum97
110YaFGYPS-NH2 DermorphinHPLCt1/2, serum97
130SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 Agouti-related protein (83-132)HPLCt1/2, serum64
131fCYwKVCT-NH2 RC-121Intravenous injection (multiple time regression)t1/2, serum11
132Ac-fCYwKVCT-NH2 RC-161Intravenous injection (multiple time regression)t1/2, serum11