Brainpeps Results

Brainpeps®

Search hits: 54
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideEfflux study (ICV)t1/2, brain11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Efflux study (ICV)t1/2, brain30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)t1/2, brain30
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YEfflux study (ICV)t1/2, brain33
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Efflux study (ICV)t1/2, brain39
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinEfflux study (ICV)t1/2, brain37
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinEfflux study (ICV)t1/2, brain31
31YPWF-NH2Endomorphin-1Efflux study (ICV)t1/2, brain40
31YPWF-NH2Endomorphin-1Efflux study (ICV)t1/2, brain97
31YPWF-NH2Endomorphin-1HPLCt1/2, brain97
32YPFF-NH2Endomorphin-2, Endomorphin IIEfflux study (ICV)t1/2, brain40
32YPFF-NH2Endomorphin-2, Endomorphin IIEfflux study (ICV)t1/2, brain97
32YPFF-NH2Endomorphin-2, Endomorphin IIHPLCt1/2, brain97
32YPFF-NH2Endomorphin-2, Endomorphin IIHPLCt1/2, brain101
36YPWG-NH2Tyr-Trp-Melanocyt-stimulating hormone (MSH) release-inhibiting factor Efflux study (ICV)t1/2, brain43
37YaGF-NH-NH-FGaYBiphalinHPLCt1/2, brain91
37YaGF-NH-NH-FGaYBiphalinHPLCt1/2, brain92
47APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYPancreatic Polypeptide Efflux study (ICV)t1/2, brain47
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Efflux study (ICV)t1/2, brain149
55NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELREpidermal growth factorEfflux study (ICV)t1/2, brain54