Brainpeps Results

Brainpeps®

Search hits: 56
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideEfflux study (ICV)kout11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Efflux study (ICV)kout30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)kout30
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YEfflux study (ICV)kout33
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Efflux study (ICV)kout39
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinEfflux study (ICV)kout37
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinEfflux study (ICV)kout31
31YPWF-NH2Endomorphin-1Efflux study (ICV)kout40
31YPWF-NH2Endomorphin-1Efflux study (ICV)kout97
32YPFF-NH2Endomorphin-2, Endomorphin IIEfflux study (ICV)kout40
32YPFF-NH2Endomorphin-2, Endomorphin IIEfflux study (ICV)kout97
36YPWG-NH2Tyr-Trp-Melanocyt-stimulating hormone (MSH) release-inhibiting factor Efflux study (ICV)kout43
47APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYPancreatic Polypeptide Efflux study (ICV)kout47
55NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELREpidermal growth factorEfflux study (ICV)kout54
57VPIYEKKYGQVPM(O)CDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL[Met(O)67]-(cocaine and amphetamine regulated transcript)-(55—102)Efflux study (ICV)kout58
58GLGGIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCIMahogany (1377-1428)Efflux study (ICV)kout60
61Pyr-HWSYGLRPGLuteinizing hormone-releasing hormoneEfflux study (ICV)kout66
66IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYPeptide YY (3-36)Efflux study (ICV)kout41
83c(HP)Cyclo (His-Pro)Intravenous injection (multiple time regression)kout104
93YaG-(N-Me)F-G-OH [(D)Ala2, (N-Me)Phe4, Gly-ol] EnkephalinEfflux study (ICV)kout97