Brainpeps Results

Brainpeps®

Search hits: 80
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)Vi11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Intravenous injection (multiple time regression)Vi30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Intravenous injection (multiple time regression)Vi30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38In situ brain perfusionVi30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideIntravenous injection (multiple time regression)Vi22
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIntravenous injection (multiple time regression)Vi34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIn situ brain perfusionVi34
23A-chain:GIVEQCCTSICSLYQLENYCN B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTInsulin Intravenous injection (multiple time regression)Vi32
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinIntravenous injection (multiple time regression)Vi31
27KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYAmylinIntravenous injection (multiple time regression)Vi32
27KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYAmylinIntravenous injection (multiple time regression)Vi126
31YPWF-NH2Endomorphin-1Intravenous injection (multiple time regression)Vi97
32YPFF-NH2Endomorphin-2, Endomorphin IIIntravenous injection (multiple time regression)Vi97
32YPFF-NH2Endomorphin-2, Endomorphin IIBMECVi135
37YaGF-NH-NH-FGaYBiphalinIn situ brain perfusionVi91
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinIn situ brain perfusionVi87
40YtGFLS-NH2SAM 995In situ brain perfusionVi26
41YtGFLS-(β-D-Glc)-NH2SAM 1095In situ brain perfusionVi26
47APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYPancreatic Polypeptide Intravenous injection (multiple time regression)Vi47
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Intravenous injection (multiple time regression)Vi149