Brainpeps Results

Brainpeps®

Search hits: 589
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
1CYFQNCPRGVasopressinCapillary depletionCD (parenchyma/serum)
1CYFQNCPRGVasopressinIntravenous injection (multiple time regression)Kin13
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)Kin11, 91, 130
6fCYwKVCW-NH2VapreotideIn situ brain perfusionPS11
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)Vi11
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)t1/2, serum11
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
7SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII Corticotropin-releasing hormoneIntravenous injection (multiple time regression)Kin24
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Intravenous injection (multiple time regression)Kin30
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 HPLC% injected dose30
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Intravenous injection (multiple time regression)Vi30
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Shake flaskLog P30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Intravenous injection (multiple time regression)Kin30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Intravenous injection (multiple time regression)Vi30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38HPLCt1/2, serum30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38In situ brain perfusionKin30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38In situ brain perfusionVi30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Shake flaskLog P30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideIntravenous injection (multiple time regression)Kin22