Brainpeps Results

Brainpeps®

Search hits: 36
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Shake flaskLog P30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Shake flaskLog P30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideShake flaskLog P22
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AShake flaskLog P35
15RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2Orexin BShake flaskLog P35
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneShake flaskLog P34
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinShake flaskLog P37
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinShake flaskLog P31
27KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYAmylinShake flaskLog P126
28HSDGTFTSEYSRLRDSARLQRLLQGLV[Tyr10] Secretin-27Shake flaskLog P77
32YPFF-NH2Endomorphin-2, Endomorphin IIShake flaskLog P101
37YaGF-NH-NH-FGaYBiphalinShake flaskLog P91
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinShake flaskLog P87
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinShake flaskLog P133
47APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYPancreatic Polypeptide Shake flaskLog P47
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Shake flaskLog P149
55NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELREpidermal growth factorShake flaskLog P54
57VPIYEKKYGQVPM(O)CDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL[Met(O)67]-(cocaine and amphetamine regulated transcript)-(55—102)Shake flaskLog P58
58GLGGIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCIMahogany (1377-1428)Shake flaskLog P60
59VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVUrocortin IIShake flaskLog P24