Brainpeps Results


Search hits: 178
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
1CYFQNCPRGVasopressinIntravenous injection (multiple time regression)Kin13
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)Kin11, 91, 130
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)Vi11
6fCYwKVCW-NH2VapreotideIntravenous injection (multiple time regression)t1/2, serum11
7SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII Corticotropin-releasing hormoneIntravenous injection (multiple time regression)Kin24
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Intravenous injection (multiple time regression)Kin30
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Intravenous injection (multiple time regression)Vi30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Intravenous injection (multiple time regression)Kin30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Intravenous injection (multiple time regression)Vi30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideIntravenous injection (multiple time regression)Kin22
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideIntravenous injection (multiple time regression)Vi22
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YIntravenous injection (multiple time regression)Kin33
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AIntravenous injection (multiple time regression)Kin35
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Intravenous injection (multiple time regression)Kin39
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIntravenous injection (multiple time regression)Kin34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIntravenous injection (multiple time regression)Vi34
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinIntravenous injection (multiple time regression)Kin37
22DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2Urocortin-IIntravenous injection (multiple time regression)Kin18, 38
22DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2Urocortin-IIntravenous injection (multiple time regression)Kin113
23A-chain:GIVEQCCTSICSLYQLENYCN B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTInsulin Intravenous injection (multiple time regression)Kin32