Brainpeps Results

Brainpeps®

Search hits: 95
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideIn situ brain perfusionPS11
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38In situ brain perfusionKin30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38In situ brain perfusionVi30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideIn situ brain perfusionKin22
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4In situ brain perfusionKin39
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIn situ brain perfusionKin34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneIn situ brain perfusionVi34
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinIn situ brain perfusionKin37
22DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2Urocortin-IIn situ brain perfusionKin18
28HSDGTFTSEYSRLRDSARLQRLLQGLV[Tyr10] Secretin-27In situ brain perfusionKin77
37YaGF-NH-NH-FGaYBiphalinIn situ brain perfusionKin91
37YaGF-NH-NH-FGaYBiphalinIn situ brain perfusionVi91
37YaGF-NH-NH-FGaYBiphalinIn situ brain perfusionP91
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinIn situ brain perfusionKin87
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinIn situ brain perfusionVi87
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinIn situ brain perfusion (single time)Kin87
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinIn situ brain perfusion (single time)RBr38
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinCapillary depletion-in situ brain perfusionRpellet38
38Y-Pen-GF-PenD-Penicillamine-D-Penicillamine EnkephalinCapillary depletion-in situ brain perfusionRsupernatant38
40YtGFLS-NH2SAM 995In situ brain perfusionKin26