Brainpeps Results

Brainpeps®

Search hits: 53
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 HPLC% injected dose30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38HPLCt1/2, serum30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AHPLCt1/2, serum35
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AHPLC% injected dose35
15RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2Orexin BHPLCt1/2, serum35
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4HPLC% injected dose39
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4HPLC% injected dose39
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinHPLC% injected dose37
31YPWF-NH2Endomorphin-1HPLCt1/2, serum97
31YPWF-NH2Endomorphin-1HPLCt1/2, brain97
32YPFF-NH2Endomorphin-2, Endomorphin IIHPLCt1/2, serum97
32YPFF-NH2Endomorphin-2, Endomorphin IIHPLCt1/2, brain97