Brainpeps Results

Brainpeps®

Search hits: 95
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideEfflux study (ICV)t1/2, brain11
6fCYwKVCW-NH2VapreotideEfflux study (ICV)kout11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Efflux study (ICV)t1/2, brain30
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 Efflux study (ICV)kout30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)t1/2, brain30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)% injected dose30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)kout30
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YEfflux study (ICV)t1/2, brain33
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YEfflux study (ICV)kout33
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Efflux study (ICV)t1/2, brain39
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Efflux study (ICV)kout39
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinEfflux study (ICV)t1/2, brain37
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinEfflux study (ICV)kout37
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinEfflux study (ICV)t1/2, brain31
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinEfflux study (ICV)kout31
31YPWF-NH2Endomorphin-1Efflux study (ICV)t1/2, brain40
31YPWF-NH2Endomorphin-1Efflux study (ICV)kout40
31YPWF-NH2Endomorphin-1Efflux study (ICV)t1/2, brain97
31YPWF-NH2Endomorphin-1Efflux study (ICV)kout97
32YPFF-NH2Endomorphin-2, Endomorphin IIEfflux study (ICV)t1/2, brain40