Brainpeps Results

Brainpeps®

Search hits: 12
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Capillary depletionCD (capillary/serum)39
40YtGFLS-NH2SAM 995Capillary depletionCD (capillary/serum)26
41YtGFLS-(β-D-Glc)-NH2SAM 1095Capillary depletionCD (capillary/serum)26
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Capillary depletionCD (capillary/serum)149
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Intravenous injection (multiple time regression)CD (capillary/serum)13
55NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELREpidermal growth factorCapillary depletionCD (capillary/serum)54
59VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVUrocortin IICapillary depletionCD (capillary/serum)24
66IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYPeptide YY (3-36)Capillary depletionCD (capillary/serum)41
91YrFK DALDACapillary depletionCD (capillary/serum)84
130SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 Agouti-related protein (83-132)Capillary depletionCD (capillary/serum)64
141Pyr-N(CPHR)CPRG-NH2cationic AVP4-9Capillary depletionCD (capillary/serum)106
174(NαMe)RK-(3,4-dehydro)PWtLLNT1, Neurotensin8-13 analogCapillary depletionCD (capillary/serum)122