Brainpeps Results

Brainpeps®

Search hits: 5
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4Capillary depletionCD (brain/serum)39
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Capillary depletionCD (brain/serum)149
48VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELNesfatin-1Intravenous injection (multiple time regression)CD (brain/serum)13
59VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVUrocortin IICapillary depletionCD (brain/serum)24
130SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 Agouti-related protein (83-132)Capillary depletionCD (brain/serum)64