Brainpeps Results

Brainpeps®

Search hits: 34
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMethodResponseReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
6fCYwKVCW-NH2VapreotideHPLC% injected dose11
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 HPLC% injected dose30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38Efflux study (ICV)% injected dose30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideHPLC% injected dose22
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AHPLC% injected dose35
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4HPLC% injected dose39
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4HPLC% injected dose39
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneHPLC% injected dose34
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinHPLC% injected dose37
23A-chain:GIVEQCCTSICSLYQLENYCN B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTInsulin Intravenous injection (multiple time regression)% injected dose32
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinIntravenous injection (multiple time regression)% injected dose31
25GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPRGhrelinIntravenous injection (multiple time regression)% injected dose31
27KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYAmylinIntravenous injection (multiple time regression)% injected dose32
28HSDGTFTSEYSRLRDSARLQRLLQGLV[Tyr10] Secretin-27Intravenous injection (multiple time regression)% injected dose77
37YaGF-NH-NH-FGaYBiphalinHPLC% injected dose29