Brainpeps Results

Brainpeps®

Search hits: 234
ID This field contains the IDs of the peptides listed. For more details, please click its ID. SequenceTrivial nameMolecular FormulaReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
1CYFQNCPRGVasopressinC46H64N14O13S213
2CYIQNCPLGOxytocinC43H65N11O13S2
3Pyr-HPThyrotropin releasing hormoneC16H21N5O5124, 128
4AGCKNFFWKTFTSCSomatostatin-14C76H104N18O19S2
5fCFwKTCTOctreotideC49H64N10O11S2
6fCYwKVCW-NH2VapreotideC57H70N12O9S211, 91, 130
7SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII Corticotropin-releasing hormoneC208H343N59O64S224
8HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Pituitary adenylate cyclase-activating polypeptide-27 C142H224N40O39S1 30
9HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Pituitary adenylate cyclase-activating polypeptide-38C203H331N63O53S1 30
10HSDAVFTDNYTRLRKQMAVKKYLNSILNVasoactive intestinal peptideC147H237N43O43S122
11YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYNeuropeptide YC190H286N54O58 33
12SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFAdrenocorticotropic hormoneC207H308N56O58S1
13DFDMLRCMLGRVYRPCWQVMelanin-concentrating hormoneC105H160N30O26S4
14Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2Orexin AC152H243N47O44S4 35
15RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2Orexin BC126H215N45O34S1 35
16HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSExendin-4C184H281N49O61S139
17DFDMLRCMLGRVFRPCWQYPhe13,Tyr19-Melanin concentrating hormoneC109H160N30O26S434
18YaFDVVG-NH2Deltorphin I, [D-Ala2]deltorphin I, Deltorphin CC37H52N8O10 132
19YaFEVVG-NH2Deltorphin II, [D-Ala2]deltorphin IIC38H54N8O10 132
21YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYAdrenomedullinC242H383N76O76S5 37